PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g029580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 160aa    MW: 18588.5 Da    PI: 11.1357
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g029580.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR149.31.6e-152791090
              FAR1 10 vGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                      +GF +r+ +s+ks+r+g+i++r + C     +++  +     +++r   r gC+a++ vk+ek g+w+v k++ +HnH+l+
  Sopen06g029580.1  2 TGFITRVLSSRKSERDGSIISRGLGCRGIPDNQRPVSL---VNQKRDRRRDGCTAMILVKREKPGTWVVRKFVRDHNHPLV 79
                      7*************************876666666555...778888999*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-13279IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MTGFITRVLS SRKSERDGSI ISRGLGCRGI PDNQRPVSLV NQKRDRRRDG CTAMILVKRE  60
KPGTWVVRKF VRDHNHPLVM PPSKRRPTPD EKDKRIQELT TELRTKKRLT AAYREQLLSL  120
MKDVESHNEH LSTKVQAVQS ILKELEAKRQ ELSDHIVHHK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-148HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015077863.11e-115PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like
TrEMBLK4C9401e-108K4C940_SOLLC; Uncharacterized protein
STRINGSolyc06g073210.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-35FAR1 family protein